Mucolipin 3 antibody (70R-5140)

Rabbit polyclonal Mucolipin 3 antibody raised against the middle region of MCOLN3

Synonyms Polyclonal Mucolipin 3 antibody, Anti-Mucolipin 3 antibody, MCOLN3 antibody, Mucolipin -3, Mucolipin 3 antibody, Mucolipin -3 antibody, Mucolipin 3, MGC71509 antibody, FLJ11006 antibody, TRPML3 antibody, TRP-ML3 antibody, Mucolipin 3, FLJ36629 antibody
Specificity Mucolipin 3 antibody was raised against the middle region of MCOLN3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Mucolipin 3 antibody was raised using the middle region of MCOLN3 corresponding to a region with amino acids TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI
Assay Information Mucolipin 3 Blocking Peptide, catalog no. 33R-9348, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 3 antibody

Images

Western Blot analysis using Mucolipin 3 antibody (70R-5140)

Mucolipin 3 antibody (70R-5140) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCOLN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mucolipins constitute a family of cation channel proteins with homologs in mouse, Drosophila, and C. elegans. Mutations in the human MCOLN1 gene cause mucolipodosis IV.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Mucolipin 3 antibody (70R-5140) | Mucolipin 3 antibody (70R-5140) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors