MVP antibody (70R-2052)

Rabbit polyclonal MVP antibody raised against the N terminal of MVP

Synonyms Polyclonal MVP antibody, Anti-MVP antibody, LRP antibody, Major Vault Protein antibody, VAULT1 antibody
Specificity MVP antibody was raised against the N terminal of MVP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM
Assay Information MVP Blocking Peptide, catalog no. 33R-5769, is also available for use as a blocking control in assays to test for specificity of this MVP antibody

Images

Western Blot analysis using MVP antibody (70R-2052)

MVP antibody (70R-2052) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MVP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MVP is required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. MVP down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. MVP down-regulates SRC activity and signaling through MAP kinases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MVP antibody (70R-2052) | MVP antibody (70R-2052) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors