MYD88 Blocking Peptide (33R-9003)

A synthetic peptide for use as a blocking control in assays to test for specificity of MYD88 antibody, catalog no. 70R-5823

Synonyms MYD88 control peptide, MYD88 antibody Blocking Peptide, Anti-MYD88 Blocking Peptide, Myeloid Differentiation Primary Response Gene 88 Blocking Peptide, MYD88, MYD-88, MYD 88, MYD-88 Blocking Peptide, MYD 88 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors