MYD88 Blocking Peptide (33R-9003)
A synthetic peptide for use as a blocking control in assays to test for specificity of MYD88 antibody, catalog no. 70R-5823
Overview
Overview
| Synonyms | MYD88 control peptide, MYD88 antibody Blocking Peptide, Anti-MYD88 Blocking Peptide, Myeloid Differentiation Primary Response Gene 88 Blocking Peptide, MYD88, MYD-88, MYD 88, MYD-88 Blocking Peptide, MYD 88 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR |
|---|---|
| Molecular Weight | 33 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product