MYL3 antibody (70R-3335)

Rabbit polyclonal MYL3 antibody raised against the N terminal of MYL3

Synonyms Polyclonal MYL3 antibody, Anti-MYL3 antibody, Myosin Light Chain 3 Alkali Ventricular Skeletal Slow antibody, VLC1 antibody, MYL-3 antibody, MYL 3, MYL3, MLC1V antibody, MYL 3 antibody, MYL-3, CMH8 antibody
Specificity MYL3 antibody was raised against the N terminal of MYL3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MYL3 antibody was raised using the N terminal of MYL3 corresponding to a region with amino acids VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG
Assay Information MYL3 Blocking Peptide, catalog no. 33R-9494, is also available for use as a blocking control in assays to test for specificity of this MYL3 antibody


Western Blot analysis using MYL3 antibody (70R-3335)

MYL3 antibody (70R-3335) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MYL3 antibody (70R-3335) | MYL3 antibody (70R-3335) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors