MYL6 antibody (70R-2678)

Rabbit polyclonal MYL6 antibody raised against the middle region of MYL6

Synonyms Polyclonal MYL6 antibody, Anti-MYL6 antibody, MYL 6 antibody, MYL6, Myosin Light Chain 6 Alkali Smooth Muscle And Non-Muscle antibody, ESMLC antibody, LC17-NM antibody, MYL 6, MLC1SM antibody, MYL-6 antibody, MLC3SM antibody, LC17A antibody, MYL-6, MLC3NM antibody, LC17B antibody, LC17-GI antibody
Specificity MYL6 antibody was raised against the middle region of MYL6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MYL6 antibody was raised using the middle region of MYL6 corresponding to a region with amino acids PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
Assay Information MYL6 Blocking Peptide, catalog no. 33R-7224, is also available for use as a blocking control in assays to test for specificity of this MYL6 antibody


Immunohistochemical staining using MYL6 antibody (70R-2678)

MYL6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYL6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MYL6 antibody (70R-2678) | MYL6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MYL6 antibody (70R-2678) | MYL6 antibody (70R-2678) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors