MYLIP antibody (70R-2736)

Rabbit polyclonal MYLIP antibody raised against the middle region of MYLIP

Synonyms Polyclonal MYLIP antibody, Anti-MYLIP antibody, Myosin Regulatory Light Chain Interacting Protein antibody, MIR antibody
Specificity MYLIP antibody was raised against the middle region of MYLIP
Cross Reactivity Human,Mouse
Applications WB
Immunogen MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE
Assay Information MYLIP Blocking Peptide, catalog no. 33R-1817, is also available for use as a blocking control in assays to test for specificity of this MYLIP antibody

Images

Western Blot analysis using MYLIP antibody (70R-2736)

MYLIP antibody (70R-2736) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MYLIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MYLIP antibody (70R-2736) | MYLIP antibody (70R-2736) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors