Myoglobin antibody (70R-2242)

Rabbit polyclonal Myoglobin antibody raised against the N terminal of MB

Synonyms Polyclonal Myoglobin antibody, Anti-Myoglobin antibody, PVALB antibody, MGC13548 antibody, MB antibody
Specificity Myoglobin antibody was raised against the N terminal of MB
Cross Reactivity Human
Applications WB
Immunogen Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Assay Information Myoglobin Blocking Peptide, catalog no. 33R-6045, is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody


Western Blot analysis using Myoglobin antibody (70R-2242)

Myoglobin antibody (70R-2242) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Myoglobin antibody (70R-2242) | Myoglobin antibody (70R-2242) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors