Myotrophin antibody (70R-2590)

Rabbit polyclonal Myotrophin antibody raised against the middle region of MTPN

Synonyms Polyclonal Myotrophin antibody, Anti-Myotrophin antibody, V-1 antibody, MTPN antibody, GCDP antibody, FLJ31098 antibody
Specificity Myotrophin antibody was raised against the middle region of MTPN
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV
Assay Information Myotrophin Blocking Peptide, catalog no. 33R-3534, is also available for use as a blocking control in assays to test for specificity of this Myotrophin antibody


Western Blot analysis using Myotrophin antibody (70R-2590)

Myotrophin antibody (70R-2590) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTPN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Myotrophin antibody (70R-2590) | Myotrophin antibody (70R-2590) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors