Myotrophin Blocking Peptide (33R-3534)

A synthetic peptide for use as a blocking control in assays to test for specificity of MTPN antibody, catalog no. 70R-2590

Synonyms Myotrophin control peptide, Myotrophin antibody Blocking Peptide, Anti-Myotrophin Blocking Peptide, FLJ31098 Blocking Peptide, GCDP Blocking Peptide, V-1 Blocking Peptide, MTPN Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV
Molecular Weight 13 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors