Myotrophin Blocking Peptide (33R-3534)
A synthetic peptide for use as a blocking control in assays to test for specificity of MTPN antibody, catalog no. 70R-2590
Overview
Overview
| Synonyms | Myotrophin control peptide, Myotrophin antibody Blocking Peptide, Anti-Myotrophin Blocking Peptide, FLJ31098 Blocking Peptide, GCDP Blocking Peptide, V-1 Blocking Peptide, MTPN Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV |
|---|---|
| Molecular Weight | 13 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product