Myxovirus Blocking Peptide (33R-4250)
A synthetic peptide for use as a blocking control in assays to test for specificity of MX1 antibody, catalog no. 70R-5937
Overview
Overview
| Synonyms | Myxovirus control peptide, Myxovirus antibody Blocking Peptide, Anti-Myxovirus Blocking Peptide, IFI-78K Blocking Peptide, IFI78 Blocking Peptide, MX Blocking Peptide, MxA Blocking Peptide, Influenza Virus Resistance 1 Interferon-Inducible Protein P78 Blocking Peptide, MX1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG |
|---|---|
| Molecular Weight | 75 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product