NAPE-PLD antibody (70R-3193)

Rabbit polyclonal NAPE-PLD antibody raised against the N terminal Of Nape-Pld

Synonyms Polyclonal NAPE-PLD antibody, Anti-NAPE-PLD antibody, DKFZp781D1098 antibody
Specificity NAPE-PLD antibody was raised against the N terminal Of Nape-Pld
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV
Assay Information NAPE-PLD Blocking Peptide, catalog no. 33R-9379, is also available for use as a blocking control in assays to test for specificity of this NAPE-PLD antibody

Images

Western Blot analysis using NAPE-PLD antibody (70R-3193)

NAPE-PLD antibody (70R-3193) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NAPE-PLD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NAPE-PLD antibody (70R-3193) | NAPE-PLD antibody (70R-3193) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors