NARG1L Blocking Peptide (33R-7993)
A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1L antibody, catalog no. 70R-2694
Overview
Overview
| Synonyms | NARG1L control peptide, NARG1L antibody Blocking Peptide, Anti-NARG1L Blocking Peptide, Nmda Receptor Regulated 1-Like Blocking Peptide, MGC40612 Blocking Peptide, RP11-396A22.1 Blocking Peptide, NARG1L, NARGL-1, NARGL 1, NARGL-1 Blocking Peptide, NARGL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL |
|---|---|
| Molecular Weight | 101 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NARG1L may belong to a complex displaying N-terminal acetyltransferase activity. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product