NARG1L Blocking Peptide (33R-7993)

A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1L antibody, catalog no. 70R-2694

Synonyms NARG1L control peptide, NARG1L antibody Blocking Peptide, Anti-NARG1L Blocking Peptide, Nmda Receptor Regulated 1-Like Blocking Peptide, MGC40612 Blocking Peptide, RP11-396A22.1 Blocking Peptide, NARG1L, NARGL-1, NARGL 1, NARGL-1 Blocking Peptide, NARGL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL
Molecular Weight 101 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NARG1L may belong to a complex displaying N-terminal acetyltransferase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors