NASP antibody (70R-2036)

Rabbit polyclonal NASP antibody

Synonyms Polyclonal NASP antibody, Anti-NASP antibody, MGC20372 antibody, DKFZp547F162 antibody, FLJ35510 antibody, FLB7527 antibody, PRO1999 antibody, FLJ31599 antibody, Nuclear Autoantigenic Sperm Protein antibody, MGC2297 antibody, MGC19722 antibody, Histone-Binding antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV
Assay Information NASP Blocking Peptide, catalog no. 33R-4313, is also available for use as a blocking control in assays to test for specificity of this NASP antibody

Images

Western blot analysis using NASP antibody (70R-2036)

Recommended NASP Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NASP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using NASP antibody (70R-2036) | Recommended NASP Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using NASP antibody (70R-2036) | Testis

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors