NAT15 antibody (70R-2380)

Rabbit polyclonal NAT15 antibody

Synonyms Polyclonal NAT15 antibody, Anti-NAT15 antibody, Gcn5-Related Putative antibody, NAT-15 antibody, N-Acetyltransferase 15 antibody, NAT15, FLJ11693 antibody, NAT 15, NAT-15, NAT 15 antibody
Cross Reactivity Human
Applications WB
Immunogen NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
Assay Information NAT15 Blocking Peptide, catalog no. 33R-2239, is also available for use as a blocking control in assays to test for specificity of this NAT15 antibody

Images

Western Blot analysis using NAT15 antibody (70R-2380)

NAT15 antibody (70R-2380) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NAT15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NAT15 most likely functions as an N-acetyltransferase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NAT15 antibody (70R-2380) | NAT15 antibody (70R-2380) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors