NCAM1 Blocking Peptide (33R-1159)
A synthetic peptide for use as a blocking control in assays to test for specificity of NCAM1 antibody, catalog no. 70R-9936
Overview
Overview
| Synonyms | NCAM1 control peptide, NCAM1 antibody Blocking Peptide, Anti-NCAM1 Blocking Peptide, neural cell adhesion molecule 1 Blocking Peptide, CD56 Blocking Peptide, MSK39 Blocking Peptide, NCAM Blocking Peptide, NCAM1, NCAM-1, NCAM 1, NCAM-1 Blocking Peptide, NCAM 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE |
|---|---|
| Molecular Weight | 39 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product