NCAM1 Blocking Peptide (33R-1159)

A synthetic peptide for use as a blocking control in assays to test for specificity of NCAM1 antibody, catalog no. 70R-9936

Synonyms NCAM1 control peptide, NCAM1 antibody Blocking Peptide, Anti-NCAM1 Blocking Peptide, neural cell adhesion molecule 1 Blocking Peptide, CD56 Blocking Peptide, MSK39 Blocking Peptide, NCAM Blocking Peptide, NCAM1, NCAM-1, NCAM 1, NCAM-1 Blocking Peptide, NCAM 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors