NCF4 antibody (70R-5753)

Rabbit polyclonal NCF4 antibody raised against the middle region of NCF4

Synonyms Polyclonal NCF4 antibody, Anti-NCF4 antibody, NCF antibody, NCF4, MGC3810 antibody, NCF-4, Neutrophil Cytosolic Factor 4 40Kda antibody, SH3PXD4 antibody, NCF 4 antibody, P40PHOX antibody, NCF 4, NCF-4 antibody
Specificity NCF4 antibody was raised against the middle region of NCF4
Cross Reactivity Human
Applications WB
Immunogen NCF4 antibody was raised using the middle region of NCF4 corresponding to a region with amino acids TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF
Assay Information NCF4 Blocking Peptide, catalog no. 33R-9086, is also available for use as a blocking control in assays to test for specificity of this NCF4 antibody

Images

Western Blot analysis using NCF4 antibody (70R-5753)

NCF4 antibody (70R-5753) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NCF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling event.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NCF4 antibody (70R-5753) | NCF4 antibody (70R-5753) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors