NCKAP1L Blocking Peptide (33R-1806)

A synthetic peptide for use as a blocking control in assays to test for specificity of NCKAP1L antibody, catalog no. 70R-8713

Synonyms NCKAP1L control peptide, NCKAP1L antibody Blocking Peptide, Anti-NCKAP1L Blocking Peptide, NCK-associated protein 1-like Blocking Peptide, HEM1 Blocking Peptide, NCKAP1L, NCKAPL-1, NCKAPL 1, NCKAPL-1 Blocking Peptide, NCKAPL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII
Molecular Weight 128 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NCKAP1L is a member of the HEM family of tissue-specific transmembrane proteins which are highly conserved from invertebrates through mammals. This gene is only expressed in hematopoietic cells, while hematopoietic protein 2 is preferentially expressed in brain, heart, liver and testis. The function of the HEM1 product has not been established but it is thought to play an essential role in oogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors