NCKAP1L Blocking Peptide (33R-1806)
A synthetic peptide for use as a blocking control in assays to test for specificity of NCKAP1L antibody, catalog no. 70R-8713
Overview
Overview
| Synonyms | NCKAP1L control peptide, NCKAP1L antibody Blocking Peptide, Anti-NCKAP1L Blocking Peptide, NCK-associated protein 1-like Blocking Peptide, HEM1 Blocking Peptide, NCKAP1L, NCKAPL-1, NCKAPL 1, NCKAPL-1 Blocking Peptide, NCKAPL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | CSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEII |
|---|---|
| Molecular Weight | 128 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NCKAP1L is a member of the HEM family of tissue-specific transmembrane proteins which are highly conserved from invertebrates through mammals. This gene is only expressed in hematopoietic cells, while hematopoietic protein 2 is preferentially expressed in brain, heart, liver and testis. The function of the HEM1 product has not been established but it is thought to play an essential role in oogenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product