NCRNA00114 Blocking Peptide (33R-8438)
A synthetic peptide for use as a blocking control in assays to test for specificity of NCRNA00114 antibody, catalog no. 70R-3296
Overview
Overview
| Synonyms | NCRNA00114 control peptide, NCRNA00114 antibody Blocking Peptide, Anti-NCRNA00114 Blocking Peptide, Non coding RNA 114 Blocking Peptide, NCRNA00114, NCRNA00-114, NCRNA00 114, NCRNA00-114 Blocking Peptide, NCRNA00 114 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT |
|---|---|
| Molecular Weight | 15 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of NCRNA00114 is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product