NCRNA00114 Blocking Peptide (33R-8438)

A synthetic peptide for use as a blocking control in assays to test for specificity of NCRNA00114 antibody, catalog no. 70R-3296

Synonyms NCRNA00114 control peptide, NCRNA00114 antibody Blocking Peptide, Anti-NCRNA00114 Blocking Peptide, Non coding RNA 114 Blocking Peptide, NCRNA00114, NCRNA00-114, NCRNA00 114, NCRNA00-114 Blocking Peptide, NCRNA00 114 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT
Molecular Weight 15 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of NCRNA00114 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors