NDUFS3 antibody (70R-2515)

Rabbit polyclonal NDUFS3 antibody raised against the middle region of NDUFS3

Synonyms Polyclonal NDUFS3 antibody, Anti-NDUFS3 antibody, Ubiquinone Fe-S Protein 3 30Kda antibody, NDUFS 3, NDUFS3, NDUFS 3 antibody, NDUFS-3 antibody, NDUFS-3, Nadh Dehydrogenase antibody
Specificity NDUFS3 antibody was raised against the middle region of NDUFS3
Cross Reactivity Human
Applications WB
Immunogen NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ
Assay Information NDUFS3 Blocking Peptide, catalog no. 33R-1398, is also available for use as a blocking control in assays to test for specificity of this NDUFS3 antibody


Western Blot analysis using NDUFS3 antibody (70R-2515)

NDUFS3 antibody (70R-2515) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDUFS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH, ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NDUFS3 antibody (70R-2515) | NDUFS3 antibody (70R-2515) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors