NDUFS3 antibody (70R-5325)

Rabbit polyclonal NDUFS3 antibody raised against the middle region of NDUFS3

Synonyms Polyclonal NDUFS3 antibody, Anti-NDUFS3 antibody, NDUFS-3, Ubiquinone Fe-S Protein 3 30Kda antibody, Nadh Dehydrogenase antibody, NDUFS-3 antibody, NDUFS 3, NDUFS3, NDUFS 3 antibody
Specificity NDUFS3 antibody was raised against the middle region of NDUFS3
Cross Reactivity Human,Mouse
Applications WB
Immunogen NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Assay Information NDUFS3 Blocking Peptide, catalog no. 33R-2797, is also available for use as a blocking control in assays to test for specificity of this NDUFS3 antibody

Images

Western Blot analysis using NDUFS3 antibody (70R-5325)

NDUFS3 antibody (70R-5325) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NDUFS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NDUFS3 antibody (70R-5325) | NDUFS3 antibody (70R-5325) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors