NEDD1 antibody (70R-3130)

Rabbit polyclonal NEDD1 antibody raised against the N terminal of NEDD1

Synonyms Polyclonal NEDD1 antibody, Anti-NEDD1 antibody, NEDD-1 antibody, NEDD 1 antibody, NEDD 1, FLJ35902 antibody, GCP-WD antibody, NEDD-1, NEDD1, Neural Precursor Cell Expressed Developmentally Down-Regulated 1 antibody, TUBGCP7 antibody
Specificity NEDD1 antibody was raised against the N terminal of NEDD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV
Assay Information NEDD1 Blocking Peptide, catalog no. 33R-6323, is also available for use as a blocking control in assays to test for specificity of this NEDD1 antibody


Western Blot analysis using NEDD1 antibody (70R-3130)

NEDD1 antibody (70R-3130) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEDD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NEDD1 antibody (70R-3130) | NEDD1 antibody (70R-3130) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors