NEDD9 antibody (70R-1701)

Rabbit polyclonal NEDD9 antibody raised against the middle region of NEDD9

Synonyms Polyclonal NEDD9 antibody, Anti-NEDD9 antibody, NEDD 9 antibody, dJ761I2.1 antibody, NEDD-9 antibody, dJ49G10.2 antibody, HEF1 antibody, CAS-L antibody, NEDD9, NEDD-9, CASL antibody, Neural Precursor Cell Expressed Developmentally Down-Regulated 9 antibody, NEDD 9
Specificity NEDD9 antibody was raised against the middle region of NEDD9
Cross Reactivity Human
Applications IHC, WB
Immunogen NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
Assay Information NEDD9 Blocking Peptide, catalog no. 33R-3816, is also available for use as a blocking control in assays to test for specificity of this NEDD9 antibody


Immunohistochemical staining using NEDD9 antibody (70R-1701)

NEDD9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NEDD9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NEDD9 antibody (70R-1701) | NEDD9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using NEDD9 antibody (70R-1701) | NEDD9 antibody (70R-1701) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors