NEK11 antibody (70R-2292)

Rabbit polyclonal NEK11 antibody

Synonyms Polyclonal NEK11 antibody, Anti-NEK11 antibody, NEK-11 antibody, NEK11, Never In Mitosis Gene A- Related Kinase 11 antibody, NEK 11 antibody, NEK-11, NEK 11, Nima antibody, FLJ23495 antibody
Cross Reactivity Human
Applications WB
Immunogen NEK11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
Assay Information NEK11 Blocking Peptide, catalog no. 33R-4339, is also available for use as a blocking control in assays to test for specificity of this NEK11 antibody


Western Blot analysis using NEK11 antibody (70R-2292)

NEK11 antibody (70R-2292) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEK11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NEK11 antibody (70R-2292) | NEK11 antibody (70R-2292) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors