NEK6 antibody (70R-5777)

Rabbit polyclonal NEK6 antibody

Synonyms Polyclonal NEK6 antibody, Anti-NEK6 antibody, Never In Mitosis Gene A-Related Kinase 6 antibody, NEK-6 antibody, NEK6, NEK 6 antibody, NEK-6, NEK 6, Nima antibody, SID6-1512 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR
Assay Information NEK6 Blocking Peptide, catalog no. 33R-3041, is also available for use as a blocking control in assays to test for specificity of this NEK6 antibody

Images

Western Blot analysis using NEK6 antibody (70R-5777)

NEK6 antibody (70R-5777) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NEK6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NEK6 antibody (70R-5777) | NEK6 antibody (70R-5777) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors