NELF antibody (70R-1128)

Rabbit polyclonal NELF antibody raised against the middle region of NELF

Synonyms Polyclonal NELF antibody, Anti-NELF antibody, MGC125369 antibody, RP11-48C7.1 antibody, Nasal Embryonic Lhrh Factor antibody
Specificity NELF antibody was raised against the middle region of NELF
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG
Assay Information NELF Blocking Peptide, catalog no. 33R-7887, is also available for use as a blocking control in assays to test for specificity of this NELF antibody

Images

Western Blot analysis using NELF antibody (70R-1128)

NELF antibody (70R-1128) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NELF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NELF influences outgrowth of olfactory axons and migration of LHRH neurons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NELF antibody (70R-1128) | NELF antibody (70R-1128) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors