NET1 antibody (70R-3140)

Rabbit polyclonal NET1 antibody raised against the middle region of NET1

Synonyms Polyclonal NET1 antibody, Anti-NET1 antibody, NET 1 antibody, Neuroepithelial Cell Transforming Gene 1 antibody, ARHGEF8 antibody, NET1A antibody, NET1, NET-1 antibody, NET-1, NET 1
Specificity NET1 antibody was raised against the middle region of NET1
Cross Reactivity Human
Applications WB
Immunogen NET1 antibody was raised using the middle region of NET1 corresponding to a region with amino acids AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHG
Assay Information NET1 Blocking Peptide, catalog no. 33R-1273, is also available for use as a blocking control in assays to test for specificity of this NET1 antibody


Western Blot analysis using NET1 antibody (70R-3140)

NET1 antibody (70R-3140) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NET1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NET1 antibody (70R-3140) | NET1 antibody (70R-3140) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors