Neurexophilin 3 antibody (70R-4471)

Rabbit polyclonal Neurexophilin 3 antibody raised against the middle region of NXPH3

Synonyms Polyclonal Neurexophilin 3 antibody, Anti-Neurexophilin 3 antibody, NXPH3 antibody, Neurexophilin 3 antibody, Neurexophilin 3, Neurexophilin -3 antibody, Neurexophilin -3, Neurexophilin 3, NPH3 antibody
Specificity Neurexophilin 3 antibody was raised against the middle region of NXPH3
Cross Reactivity Human
Applications WB
Immunogen Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT
Assay Information Neurexophilin 3 Blocking Peptide, catalog no. 33R-6733, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 3 antibody


Western Blot analysis using Neurexophilin 3 antibody (70R-4471)

Neurexophilin 3 antibody (70R-4471) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NXPH3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Neurexophilin 3 antibody (70R-4471) | Neurexophilin 3 antibody (70R-4471) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors