NEURL Blocking Peptide (33R-8032)
A synthetic peptide for use as a blocking control in assays to test for specificity of NEURL antibody, catalog no. 70R-5243
Overview
Overview
| Synonyms | NEURL control peptide, NEURL antibody Blocking Peptide, Anti-NEURL Blocking Peptide, Neuralized Homolog Blocking Peptide, NEURL1 Blocking Peptide, RNF67 Blocking Peptide, h-neu Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKA |
|---|---|
| Molecular Weight | 62 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NEURL may be involved in protein binding, zinc ion binding and metal ion binding. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product