NFS1 antibody (70R-1097)

Rabbit polyclonal NFS1 antibody

Synonyms Polyclonal NFS1 antibody, Anti-NFS1 antibody, NFS 1 antibody, Nfs1 Nitrogen Fixation 1 Homolog antibody, NFS1, NFS-1 antibody, NFS 1, NFS-1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
Assay Information NFS1 Blocking Peptide, catalog no. 33R-9331, is also available for use as a blocking control in assays to test for specificity of this NFS1 antibody


Western Blot analysis using NFS1 antibody (70R-1097)

NFS1 antibody (70R-1097) used at 0.3125 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NFS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.3125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this geneupplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NFS1 antibody (70R-1097) | NFS1 antibody (70R-1097) used at 0.3125 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors