NGRN antibody (70R-2619)

Rabbit polyclonal NGRN antibody raised against the N terminal of NGRN

Synonyms Polyclonal NGRN antibody, Anti-NGRN antibody, DSC92 antibody, Neugrin Neurite Outgrowth Associated antibody, NEUGRIN antibody
Specificity NGRN antibody was raised against the N terminal of NGRN
Cross Reactivity Human
Applications WB
Immunogen NGRN antibody was raised using the N terminal of NGRN corresponding to a region with amino acids MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL
Assay Information NGRN Blocking Peptide, catalog no. 33R-5804, is also available for use as a blocking control in assays to test for specificity of this NGRN antibody


Western Blot analysis using NGRN antibody (70R-2619)

NGRN antibody (70R-2619) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NGRN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NGRN may be involved in neuronal differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NGRN antibody (70R-2619) | NGRN antibody (70R-2619) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors