NHEDC1 antibody (70R-2260)

Rabbit polyclonal NHEDC1 antibody raised against the N terminal of NHEDC1

Synonyms Polyclonal NHEDC1 antibody, Anti-NHEDC1 antibody, NHEDC 1, NHEDC1, MGC131641 antibody, Na+/H+ Exchanger Domain Containing 1 antibody, NHEDC 1 antibody, NHEDC-1, NHEDC-1 antibody
Specificity NHEDC1 antibody was raised against the N terminal of NHEDC1
Cross Reactivity Human
Applications WB
Immunogen NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT
Assay Information NHEDC1 Blocking Peptide, catalog no. 33R-6104, is also available for use as a blocking control in assays to test for specificity of this NHEDC1 antibody


Western Blot analysis using NHEDC1 antibody (70R-2260)

NHEDC1 antibody (70R-2260) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NHEDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NHEDC1 is a sodium/hydrogen exchanger and transmembrane protein. Highly conserved orthologs of this gene have been found in other mammalian species. The expression of NHEDC1 may be limited to testis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NHEDC1 antibody (70R-2260) | NHEDC1 antibody (70R-2260) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors