NHLRC2 Blocking Peptide (33R-10237)
A synthetic peptide for use as a blocking control in assays to test for specificity of NHLRC2 antibody, catalog no. 70R-3406
Overview
Overview
| Synonyms | NHLRC2 control peptide, NHLRC2 antibody Blocking Peptide, Anti-NHLRC2 Blocking Peptide, Nhl Repeat Containing 2 Blocking Peptide, DKFZp779F115 Blocking Peptide, FLJ20147 Blocking Peptide, FLJ25621 Blocking Peptide, FLJ33312 Blocking Peptide, MGC45492 Blocking Peptide, NHLRC2, NHLRC-2, NHLRC 2, NHLRC-2 Blocking Peptide, NHLRC 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE |
|---|---|
| Molecular Weight | 79 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of NHLRC2 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product