NIT1 Blocking Peptide (33R-9769)
A synthetic peptide for use as a blocking control in assays to test for specificity of NIT1 antibody, catalog no. 70R-2732
Overview
Overview
| Synonyms | NIT1 control peptide, NIT1 antibody Blocking Peptide, Anti-NIT1 Blocking Peptide, Nitrilase 1 Blocking Peptide, MGC57670 Blocking Peptide, NIT1, NIT-1, NIT 1, NIT-1 Blocking Peptide, NIT 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product