NIT1 Blocking Peptide (33R-9769)

A synthetic peptide for use as a blocking control in assays to test for specificity of NIT1 antibody, catalog no. 70R-2732

Synonyms NIT1 control peptide, NIT1 antibody Blocking Peptide, Anti-NIT1 Blocking Peptide, Nitrilase 1 Blocking Peptide, MGC57670 Blocking Peptide, NIT1, NIT-1, NIT 1, NIT-1 Blocking Peptide, NIT 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors