NIT2 antibody (70R-2400)

Rabbit polyclonal NIT2 antibody raised against the middle region of NIT2

Synonyms Polyclonal NIT2 antibody, Anti-NIT2 antibody, NIT 2 antibody, Nitrilase Family Member 2 antibody, NIT-2, NIT2, NIT 2, NIT-2 antibody, MGC111199 antibody
Specificity NIT2 antibody was raised against the middle region of NIT2
Cross Reactivity Human,Mouse
Applications WB
Immunogen NIT2 antibody was raised using the middle region of NIT2 corresponding to a region with amino acids VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP
Assay Information NIT2 Blocking Peptide, catalog no. 33R-9421, is also available for use as a blocking control in assays to test for specificity of this NIT2 antibody

Images

Western Blot analysis using NIT2 antibody (70R-2400)

NIT2 antibody (70R-2400) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NIT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NIT2 belongs to the UPF0012 family and contains 1 CN hydrolase domain. Overexpression of NIT2 decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NIT2 antibody (70R-2400) | NIT2 antibody (70R-2400) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors