NKIRAS1 antibody (70R-5878)

Rabbit polyclonal NKIRAS1 antibody raised against the N terminal of NKIRAS1

Synonyms Polyclonal NKIRAS1 antibody, Anti-NKIRAS1 antibody, NKIRAS1, KBRAS1 antibody, NKIRAS 1 antibody, NKIRAS-1 antibody, NKIRAS 1, Nfkb Inhibitor Interacting Ras-Like 1 antibody, kappaB-Ras1 antibody, NKIRAS-1
Specificity NKIRAS1 antibody was raised against the N terminal of NKIRAS1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NKIRAS1 antibody was raised using the N terminal of NKIRAS1 corresponding to a region with amino acids CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV
Assay Information NKIRAS1 Blocking Peptide, catalog no. 33R-1680, is also available for use as a blocking control in assays to test for specificity of this NKIRAS1 antibody

Images

Western Blot analysis using NKIRAS1 antibody (70R-5878)

NKIRAS1 antibody (70R-5878) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NKIRAS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NKIRAS1 antibody (70R-5878) | NKIRAS1 antibody (70R-5878) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors