NLGN4X Blocking Peptide (33R-8532)

A synthetic peptide for use as a blocking control in assays to test for specificity of NLGN4X antibody, catalog no. 70R-6162

Synonyms NLGN4X control peptide, NLGN4X antibody Blocking Peptide, Anti-NLGN4X Blocking Peptide, Neuroligin 4 X-Linked Blocking Peptide, ASPGX2 Blocking Peptide, AUTSX2 Blocking Peptide, HLNX Blocking Peptide, HNLX Blocking Peptide, KIAA1260 Blocking Peptide, MGC22376 Blocking Peptide, NLGN Blocking Peptide, NLGN4 Blocking Peptide, NLGN4X, NLGNX-4, NLGNX 4, NLGNX-4 Blocking Peptide, NLGNX 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN
Molecular Weight 92 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors