NLGN4X Blocking Peptide (33R-8532)
A synthetic peptide for use as a blocking control in assays to test for specificity of NLGN4X antibody, catalog no. 70R-6162
Overview
Overview
| Synonyms | NLGN4X control peptide, NLGN4X antibody Blocking Peptide, Anti-NLGN4X Blocking Peptide, Neuroligin 4 X-Linked Blocking Peptide, ASPGX2 Blocking Peptide, AUTSX2 Blocking Peptide, HLNX Blocking Peptide, HNLX Blocking Peptide, KIAA1260 Blocking Peptide, MGC22376 Blocking Peptide, NLGN Blocking Peptide, NLGN4 Blocking Peptide, NLGN4X, NLGNX-4, NLGNX 4, NLGNX-4 Blocking Peptide, NLGNX 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN |
|---|---|
| Molecular Weight | 92 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product