NME4 antibody (70R-3129)

Rabbit polyclonal NME4 antibody raised against the middle region of NME4

Synonyms Polyclonal NME4 antibody, Anti-NME4 antibody, NME 4, Non-Metastatic Cells 4 Protein Expressed In antibody, nm23-H4 antibody, NM23H4 antibody, NME-4 antibody, NME-4, NME 4 antibody, NME4
Specificity NME4 antibody was raised against the middle region of NME4
Cross Reactivity Human
Applications WB
Immunogen NME4 antibody was raised using the middle region of NME4 corresponding to a region with amino acids VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV
Assay Information NME4 Blocking Peptide, catalog no. 33R-9429, is also available for use as a blocking control in assays to test for specificity of this NME4 antibody


Western Blot analysis using NME4 antibody (70R-3129)

NME4 antibody (70R-3129) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NME4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The nucleoside diphosphate (NDP) kinases (EC are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NME4 antibody (70R-3129) | NME4 antibody (70R-3129) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors