NMNAT1 antibody (70R-1042)

Rabbit polyclonal NMNAT1 antibody raised against the N terminal of NMNAT1

Synonyms Polyclonal NMNAT1 antibody, Anti-NMNAT1 antibody, PNAT-1 antibody, Nicotinamide Nucleotide Adenylyltransferase 1 antibody, PNAT1 antibody, NMNAT 1, NMNAT-1, NMNAT 1 antibody, NMNAT-1 antibody, NMNAT1, NMNAT antibody
Specificity NMNAT1 antibody was raised against the N terminal of NMNAT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL
Assay Information NMNAT1 Blocking Peptide, catalog no. 33R-7409, is also available for use as a blocking control in assays to test for specificity of this NMNAT1 antibody


Western Blot analysis using NMNAT1 antibody (70R-1042)

NMNAT1 antibody (70R-1042) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NMNAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NMNAT1 antibody (70R-1042) | NMNAT1 antibody (70R-1042) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors