NMRAL1 Blocking Peptide (33R-8999)

A synthetic peptide for use as a blocking control in assays to test for specificity of NMRAL1 antibody, catalog no. 70R-3374

Synonyms NMRAL1 control peptide, NMRAL1 antibody Blocking Peptide, Anti-NMRAL1 Blocking Peptide, Nmra-Like Family Domain Containing 1 Blocking Peptide, FLJ25918 Blocking Peptide, HSCARG Blocking Peptide, NMRAL1, NMRAL-1, NMRAL 1, NMRAL-1 Blocking Peptide, NMRAL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA
Molecular Weight 33 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein is binding, oxidoreductase activity and transcription repressor activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors