NMT1 antibody (70R-2314)

Rabbit polyclonal NMT1 antibody raised against the N terminal of NMT1

Synonyms Polyclonal NMT1 antibody, Anti-NMT1 antibody, NMT-1, NMT 1, NMT 1 antibody, NMT1, NMT antibody, NMT-1 antibody, N-Myristoyltransferase 1 antibody
Specificity NMT1 antibody was raised against the N terminal of NMT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NMT1 antibody was raised using the N terminal of NMT1 corresponding to a region with amino acids TMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFT
Assay Information NMT1 Blocking Peptide, catalog no. 33R-9200, is also available for use as a blocking control in assays to test for specificity of this NMT1 antibody

Western Blot analysis using NMT1 antibody (70R-2314)

NMT1 antibody (70R-2314) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NMT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1).

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using NMT1 antibody (70R-2314) | NMT1 antibody (70R-2314) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors