NMUR2 antibody (70R-1539)

Rabbit polyclonal NMUR2 antibody raised against the N terminal of NMUR2

Synonyms Polyclonal NMUR2 antibody, Anti-NMUR2 antibody, protein-coupled receptor fm4 antibody, NMUR2, tgr-1 antibody, Neuromedin U Receptor 2 antibody, neuromedin u receptor-type 2 antibody, neuromedin S receptor antibody, NMUR 2 antibody, neuromedin u receptor 2 antibody, nmu-r2 antibody, NMUR-2, SNORF62 antibody, NMUR-2 antibody, nmu2r antibody, NMUR 2
Specificity NMUR2 antibody was raised against the N terminal of NMUR2
Cross Reactivity Human
Applications WB
Immunogen NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV
Assay Information NMUR2 Blocking Peptide, catalog no. 33R-6432, is also available for use as a blocking control in assays to test for specificity of this NMUR2 antibody

Images

Western Blot analysis using NMUR2 antibody (70R-1539)

NMUR2 antibody (70R-1539) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NMUR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NMUR2 antibody (70R-1539) | NMUR2 antibody (70R-1539) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors