NNMT antibody (70R-1262)

Rabbit polyclonal NNMT antibody raised against the N terminal of NNMT

Synonyms Polyclonal NNMT antibody, Anti-NNMT antibody, Nicotinamide N-Methyltransferase antibody
Specificity NNMT antibody was raised against the N terminal of NNMT
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
Assay Information NNMT Blocking Peptide, catalog no. 33R-5957, is also available for use as a blocking control in assays to test for specificity of this NNMT antibody

Images

Western Blot analysis using NNMT antibody (70R-1262)

NNMT antibody (70R-1262) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NNMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NNMT antibody (70R-1262) | NNMT antibody (70R-1262) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors