NOB1 antibody (70R-3713)

Rabbit polyclonal NOB1 antibody

Synonyms Polyclonal NOB1 antibody, Anti-NOB1 antibody, NOB1P antibody, ART-4 antibody, PSMD8BP1 antibody, NOB 1 antibody, NOB-1 antibody, MST158 antibody, NOB 1, NOB1, Nin1/Rpn12 Binding Protein 1 Homolog antibody, NOB-1, MSTP158 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI
Assay Information NOB1 Blocking Peptide, catalog no. 33R-9043, is also available for use as a blocking control in assays to test for specificity of this NOB1 antibody


Western Blot analysis using NOB1 antibody (70R-3713)

NOB1 antibody (70R-3713) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOB1 may play a role in mRNA degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NOB1 antibody (70R-3713) | NOB1 antibody (70R-3713) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors