NOC3L antibody (70R-3436)

Rabbit polyclonal NOC3L antibody

Synonyms Polyclonal NOC3L antibody, Anti-NOC3L antibody, C10orf117 antibody, Nucleolar Complex Associated 3 Homolog antibody, FLJ12820 antibody, FAD24 antibody, NOCL 3 antibody, NOCL 3, NOC3L, AD24 antibody, NOCL-3 antibody, NOCL-3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NOC3L antibody was raised using a synthetic peptide corresponding to a region with amino acids TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL
Assay Information NOC3L Blocking Peptide, catalog no. 33R-9174, is also available for use as a blocking control in assays to test for specificity of this NOC3L antibody


Western Blot analysis using NOC3L antibody (70R-3436)

NOC3L antibody (70R-3436) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOC3L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOC3L belongs to the CBF/MAK21 family. It may be required for adipogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NOC3L antibody (70R-3436) | NOC3L antibody (70R-3436) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors