NODAL Blocking Peptide (33R-7373)

A synthetic peptide for use as a blocking control in assays to test for specificity of NODAL antibody, catalog no. 70R-3223

Synonyms NODAL control peptide, NODAL antibody Blocking Peptide, Anti-NODAL Blocking Peptide, Nodal Homolog Blocking Peptide, MGC138230 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ
Molecular Weight 37 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors