NODAL Blocking Peptide (33R-7373)
A synthetic peptide for use as a blocking control in assays to test for specificity of NODAL antibody, catalog no. 70R-3223
Overview
Overview
| Synonyms | NODAL control peptide, NODAL antibody Blocking Peptide, Anti-NODAL Blocking Peptide, Nodal Homolog Blocking Peptide, MGC138230 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ |
|---|---|
| Molecular Weight | 37 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product