NOL6 antibody (70R-4744)

Rabbit polyclonal NOL6 antibody

Synonyms Polyclonal NOL6 antibody, Anti-NOL6 antibody, NOL-6 antibody, NOL 6 antibody, MGC14921 antibody, UTP22 antibody, NOL 6, NOL-6, NOL6, Nucleolar Protein Family 6 antibody, MGC14896 antibody, FLJ21959 antibody, MGC20838 antibody, bA311H10.1 antibody, NRAP antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR
Assay Information NOL6 Blocking Peptide, catalog no. 33R-8759, is also available for use as a blocking control in assays to test for specificity of this NOL6 antibody

Images

Western Blot analysis using NOL6 antibody (70R-4744)

NOL6 antibody (70R-4744) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 127 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NOL6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using NOL6 antibody (70R-4744) | NOL6 antibody (70R-4744) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors