NONO antibody (70R-1316)

Rabbit polyclonal NONO antibody raised against the C terminal of NONO

Synonyms Polyclonal NONO antibody, Anti-NONO antibody, Non-Pou Domain Containing Octamer-Binding antibody
Specificity NONO antibody was raised against the C terminal of NONO
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY
Assay Information NONO Blocking Peptide, catalog no. 33R-1969, is also available for use as a blocking control in assays to test for specificity of this NONO antibody


Immunohistochemical staining using NONO antibody (70R-1316)

NONO antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NONO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using NONO antibody (70R-1316) | NONO antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.
  • Western Blot analysis using NONO antibody (70R-1316) | NONO antibody (70R-1316) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using NONO antibody (70R-1316) | NONO antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors