NOV antibody (70R-1715)

Rabbit polyclonal NOV antibody raised against the C terminal of NOV

Synonyms Polyclonal NOV antibody, Anti-NOV antibody, Nephroblastoma Overexpressed Gene antibody, IGFBP9 antibody, CCN3 antibody, NOVH antibody
Specificity NOV antibody was raised against the C terminal of NOV
Cross Reactivity Human
Applications WB
Immunogen NOV antibody was raised using the C terminal of NOV corresponding to a region with amino acids KTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGK
Assay Information NOV Blocking Peptide, catalog no. 33R-4680, is also available for use as a blocking control in assays to test for specificity of this NOV antibody


Western Blot analysis using NOV antibody (70R-1715)

NOV antibody (70R-1715) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NOV antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As an immediate-early protein, NOV is likely to play a role in cell growth regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NOV antibody (70R-1715) | NOV antibody (70R-1715) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors