NOVA1 Blocking Peptide (33R-8555)
A synthetic peptide for use as a blocking control in assays to test for specificity of NOVA1 antibody, catalog no. 70R-4832
Overview
Overview
| Synonyms | NOVA1 control peptide, NOVA1 antibody Blocking Peptide, Anti-NOVA1 Blocking Peptide, Neuro-Oncological Ventral Antigen 1 Blocking Peptide, Nova-1 Blocking Peptide, NOVA1, NOVA-1, NOVA 1, NOVA-1 Blocking Peptide, NOVA 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product