NOVA1 Blocking Peptide (33R-8555)

A synthetic peptide for use as a blocking control in assays to test for specificity of NOVA1 antibody, catalog no. 70R-4832

Synonyms NOVA1 control peptide, NOVA1 antibody Blocking Peptide, Anti-NOVA1 Blocking Peptide, Neuro-Oncological Ventral Antigen 1 Blocking Peptide, Nova-1 Blocking Peptide, NOVA1, NOVA-1, NOVA 1, NOVA-1 Blocking Peptide, NOVA 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors