NP antibody (70R-2286)

Rabbit polyclonal NP antibody raised against the middle region of NP

Synonyms Polyclonal NP antibody, Anti-NP antibody, MGC117396 antibody, MGC125915 antibody, PRO1837 antibody, MGC125916 antibody, PUNP antibody, PNP antibody, Nucleoside Phosphorylase antibody
Specificity NP antibody was raised against the middle region of NP
Cross Reactivity Human
Applications WB
Immunogen NP antibody was raised using the middle region of NP corresponding to a region with amino acids GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG
Assay Information NP Blocking Peptide, catalog no. 33R-3631, is also available for use as a blocking control in assays to test for specificity of this NP antibody


Western Blot analysis using NP antibody (70R-2286)

NP antibody (70R-2286) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Defects in NP are the cause of nucleoside phosphorylase deficiency (NP deficiency). It leads to a severe T-cell immunodeficiency with neurologic disorder in children. The specific function of NP is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using NP antibody (70R-2286) | NP antibody (70R-2286) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors